HPA054102

antibody from Atlas Antibodies

Targeting: MORF4L2 KIAA0026, MRGX

Antibody data

Submit

Validation data

Product number: HPA054102 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA054102, RRID:AB_2682379
Product name: Anti-MORF4L2
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: MSSRKQGSQPRGQQSAEEENFKKPTRSNMQRSKMR GASSGKKTAGPQQKNLEPALPGRWGGRSAENPPSG SVRKTRK
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

MORF4L2 protein structure - HPA054102 shown in red.

Enhanced validation

Submitted by: klas2
Enhanced method: Genetic validation
Main image
Experimental details: Western blot of cell lysate from U-2 OS cells transfected with either siRNA targeting MORF4L2 or control siRNA. Lane 1: Marker (250, 130, 95, 72, 55, 36, 28, 17, 10) Lane 2: Cell lysate from U-2OS cells transfected with siRNA targeting MORF4L2 Lane 3: N/A Lane 4: Cell lysate from U-2OS cells transfected with control siRNA Right image, lane 1-4: loading control
Sample type: U-2 OS
Primary Ab dilution: 1:244
Conjugate: Horseradish Peroxidase
Secondary Ab: Secondary Ab
Secondary Ab dilution: 1:3000
Knockdown/Genetic Approaches Application: Western blot
KD Reagent Type: siRNA
Downregulation: >75%
KD Reagent Prod page: KD Reagent Prod page
KD Reagent Prod no: s225173
KD Reagent Provider: Thermo Fisher Scientific
KD Reagent Prod no 2: s18539
KD Reagent Page 2: KD Reagent Page 2
KD Reagent Prod no 3: s18540
KD Reagent Page 3: KD Reagent Page 3
Antibody Lot Number: R72106
Appendix: 566c2930a30f7.pdf

Supportive validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Genetic validation
Main image
Experimental details: Western blot analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-MORF4L2 antibody. Remaining relative intensity is presented.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Recombinant expression validation
Main image
Experimental details: Western blot analysis in control (vector only transfected HEK293T lysate) and MORF4L2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY402188).