Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [9]
Submit
Validation data
Reference
Comment
Report error
- Product number
- AMAb90915 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#AMAb90915, RRID:AB_2665723
- Product name
- Anti-ITGAX
- Antibody type
- Monoclonal
- Reactivity
- Human
- Host
- Mouse
- Conjugate
- Unconjugated
- Antigen sequence
QDGLVDLAVGARGQVLLLRTRPVLWVGVSMQFIPA
EIPRSAFECREQVVSEQTLVQSNICLYIDKRSKNL
LGSRDLQSSVTLDLALDPGRLSPRATFQETKNRSL
SRVRV- Epitope
- Binds to an epitope located within the peptide sequence LYIDKRSKNLLGSRD as determined by overlapping synthetic peptides.
- Isotype
- IgG
- Antibody clone number
- CL1831
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Lane 1: Marker [kDa]Lane 2: Human tonsil
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human tonsil and kidney tissues using AMAb90915 antibody. Corresponding ITGAX RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human tonsil shows strong immunoreactivity in the dendritic cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human colon shows positivity in a subset of lymphoid cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human fallopian tube shows moderate immunoreactivity in a subset of lymphoid cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis shows absence of immunoreactivity (negative control).
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human tonsil shows strong membranous positivity in a subset of germinal and non-germinal center cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human small intestine shows moderate positivity in a subset of lymphoid cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human fallopian tube shows moderate membranous positivity in a subset of lymphoid cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human kidney shows no positivity as expected.