HPA044062

antibody from Atlas Antibodies

Targeting: STIP1 HOP, STI1

Antibody data

Submit

Validation data

Product number: HPA044062 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA044062, RRID:AB_2678795
Product name: Anti-STIP1
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: YARIGNSYFKEEKYKDAIHFYNKSLAEHRTPDVLK KCQQAEKILKEQERLAYINPDLALEEKNKGNECFQ KGDYPQAMKHYTEAIKRNPKDAKLYS
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

STIP1 protein structure - HPA044062 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex, colon, pancreas and testis using Anti-STIP1 antibody HPA044062 (A) shows similar protein distribution across tissues to independent antibody HPA039291 (B).
Antibody #2 product nr: HPA039291
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis shows strong cytoplasmic positivity in basal cells of the seminiferous ducts.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex using Anti-STIP1 antibody HPA044062.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human pancreas using Anti-STIP1 antibody HPA044062.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon using Anti-STIP1 antibody HPA044062.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis using Anti-STIP1 antibody HPA044062.
Sample type: HUMAN