Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [2]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00008673-B01P - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00008673-B01P, RRID:AB_1581829
- Product name
- VAMP8 purified MaxPab mouse polyclonal antibody (B01P)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a full-length human VAMP8 protein.
- Antigen sequence
MEEASEGGGNDRVRNLQSEVEGVKNIMTQNVERIL
ARGENLEHLRNKTEDLEATSEHFKTTSQKVARKFW
WKNVKMIVLICVIVFIIILFIVLFATGAFS- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Expression of antizyme inhibitor 2 in mast cells and role of polyamines as selective regulators of serotonin secretion.
Kanerva K, Lappalainen J, Mäkitie LT, Virolainen S, Kovanen PT, Andersson LC
PloS one 2009 Aug 31;4(8):e6858
PloS one 2009 Aug 31;4(8):e6858
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- VAMP8 MaxPab polyclonal antibody. Western Blot analysis of VAMP8 expression in A-431.
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of VAMP8 expression in transfected 293T cell line (H00008673-T01) by VAMP8 MaxPab polyclonal antibody.Lane 1: VAMP8 transfected lysate(11 KDa).Lane 2: Non-transfected lysate.