ABIN633672

antibody from antibodies-online

Targeting: ASIC2 ACCN, ACCN1, ASIC2a, BNaC1, BNC1, hBNaC1, MDEG

Western blot

Antibody data

Submit

Validation data

Product number: ABIN633672 - Provider product page
Provider: antibodies-online
Product name: anti-Amiloride-Sensitive Cation Channel 1, Neuronal (ACCN1) antibody
Antibody type: Polyclonal
Antigen: ACCN1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LLDLLGKEEDEGSHDENVSTCDTMPNHSETISHTVNVPLQTTLGTLEEIA
Description: Affinity purified
Reactivity: Human, Mouse, Rat
Host: Rabbit
Vial size: 50 μg
Concentration: 1 mg/mL
Storage: Store at 2-8°C for short periods. For longer periods of storage, store at -20°C.
Handling: Avoid repeated freeze/thaw cycles.

ASIC2 protein structure - ABIN633672 shown in red.