Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA021318 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA021318, RRID:AB_2183383
- Product name
- Anti-SAMD9
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
VSQKERRETSKQKQKGKENPDMANPSAMSTTAKGS
KSLKVELIEDKIDYTKERQPSIDLTCVSYPFDEFS
NPYRYKLDFSLQP- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references HeLa cell response proteome alterations induced by mammalian reovirus T3D infection.
Non-Biased Enrichment Does Not Improve Quantitative Proteomic Delineation of Reovirus T3D-Infected HeLa Cell Protein Alterations.
Coombs KM
Virology journal 2013 Jun 21;10:202
Virology journal 2013 Jun 21;10:202
Non-Biased Enrichment Does Not Improve Quantitative Proteomic Delineation of Reovirus T3D-Infected HeLa Cell Protein Alterations.
Jiang J, Opanubi KJ, Coombs KM
Frontiers in microbiology 2012;3:310
Frontiers in microbiology 2012;3:310
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line A-431 shows localization to cytosol & vesicles.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human lymph node shows strong cytoplasmic positivity in germinal and non-germinal center cells.
- Sample type
- HUMAN