18-272-196681

antibody from GenWay

Targeting: IL21 IL-21, Za11

ELISA

Immunohistochemistry

Antibody data

Submit

Validation data

Product number: 18-272-196681 - Provider product page
Provider: GenWay
Product name: IL21
Antibody type: Polyclonal
Antigen: Synthetic peptide: CRHLIDIVEQLKIYENDLDPELLSAPQDVK , corresponding to N terminal amino acids 32-61 of Mouse IL21.
Description: Immunogen affinity purified
Reactivity: Mouse
Host: Goat
Isotype: IgG
Vial size: 0.05 mg
Storage: Keep as concentrated solution. Store at 4C short term. For extended storage aliquot and store at -20C or below. Avoid freeze-thaw cycles.

IL21 protein structure - 18-272-196681 shown in red.