Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN184038 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Nuclear Import 7 Homolog (S. Cerevisiae) (NIP7) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-NIP7 antibody: synthetic peptide directed towards the C terminal of human NIP7
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Porcine, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
VVVYSMADIPLGFGVAAKSTQDCRKVDPMAIVVFH
QADIG EYVRHEETLT- Epitope
- C-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Activation of mTORC2 by association with the ribosome.
Transcriptome analysis of human gastric cancer.
Zinzalla V, Stracka D, Oppliger W, Hall MN
Cell 2011 Mar 4;144(5):757-68
Cell 2011 Mar 4;144(5):757-68
Transcriptome analysis of human gastric cancer.
Oh JH, Yang JO, Hahn Y, Kim MR, Byun SS, Jeon YJ, Kim JM, Song KS, Noh SM, Kim S, Yoo HS, Kim YS, Kim NS
Mammalian genome : official journal of the International Mammalian Genome Society 2005 Dec;16(12):942-54
Mammalian genome : official journal of the International Mammalian Genome Society 2005 Dec;16(12):942-54
No comments: Submit comment
No validations: Submit validation data