Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [2]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN1108602 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Prenylcysteine Oxidase 1 (PCYOX1) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-PCYOX1 antibody: synthetic peptide directed towards the C terminal of human PCYOX1.
- Description
- Purified using Protein A affinity column.
- Reactivity
- Human, Bovine, Canine
- Host
- Rabbit
- Antigen sequence
IFSQETLTKAQILKLFLSYDYAVKKPWLAYPHYKP
PEKCPSIILHDRLYY- Epitope
- C-Term
- Vial size
- 0.1 mg
- Storage
- Store lyophilized at 2-8°C or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for up to one month or in aliquots at -20°C long term.
- Handling
- Avoid repeated freezing and thawing.
Submitted references The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
Clark HF, Gurney AL, Abaya E, Baker K, Baldwin D, Brush J, Chen J, Chow B, Chui C, Crowley C, Currell B, Deuel B, Dowd P, Eaton D, Foster J, Grimaldi C, Gu Q, Hass PE, Heldens S, Huang A, Kim HS, Klimowski L, Jin Y, Johnson S, Lee J, Lewis L, Liao D, Mark M, Robbie E, Sanchez C, Schoenfeld J, Seshagiri S, Simmons L, Singh J, Smith V, Stinson J, Vagts A, Vandlen R, Watanabe C, Wieand D, Woods K, Xie MH, Yansura D, Yi S, Yu G, Yuan J, Zhang M, Zhang Z, Goddard A, Wood WI, Godowski P, Gray A
Genome research 2003 Oct;13(10):2265-70
Genome research 2003 Oct;13(10):2265-70
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Human Jurkat; WB Suggested Anti-PCYOX1 Antibody Titration: 0.5ug/ml. Positive Control: Jurkat cell lysate; PCYOX1 antibody - C-terminal region (AP42165PU-N) in Human Jurkat cells using Western Blot
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Human Liver; PCYOX1 antibody - C-terminal region (AP42165PU-N) in Human Liver cells using Immunohistochemistry
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Human Lung; . Rabbit Anti-PCYOX1 Antibody. . ARP33007 . Paraffin Embedded Tissue: Human alveolar cell . Cellular Data: Epithelial cells of renal tubule. Antibody Concentration: 4.0-8.0 ug/ml. Magnification: 400X
