Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00010110-M03 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00010110-M03, RRID:AB_566171
- Product name
- SGK2 monoclonal antibody (M03), clone 7A6
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant SGK2.
- Antigen sequence
SPINWDDLYHKRLTPPFNPNVTGPADLKHFDPEFT
QEAVSKSIGCTPDTVASSSGASSAFLGFSYAPEDD
DILDC- Isotype
- IgG
- Antibody clone number
- 7A6
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- SGK2 monoclonal antibody (M03), clone 7A6 Western Blot analysis of SGK2 expression in PC-12 ( Cat # L012V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- SGK2 monoclonal antibody (M03), clone 7A6. Western Blot analysis of SGK2 expression in K-562 ( Cat # L009V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged SGK2 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol