Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [6]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA011026 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA011026, RRID:AB_1850426
- Product name
- Anti-ARHGEF11
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
LQAEIDSRLRNSEDARGVLCEAQEAAMPEIQEQIH
DYRTKRTLGLGSLYGENDLLDLDGDPLRERQVAEK
QLAALGDILSKYEEDRSAPMDFALNTYMSHAGIRL
REARPSNTAEKAQSAPDKDKWLPFFPKTKKSSNSK
KEQDA- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Myosin-II-mediated cell shape changes and cell intercalation contribute to primitive streak formation
Lysophosphatidic acid and sphingosine-1-phosphate promote morphogenesis and block invasion of prostate cancer cells in three-dimensional organotypic models.
Rozbicki E, Chuai M, Karjalainen A, Song F, Sang H, Martin R, Knölker H, MacDonald M, Weijer C
Nature Cell Biology 2015 March;17(4):397-408
Nature Cell Biology 2015 March;17(4):397-408
Lysophosphatidic acid and sphingosine-1-phosphate promote morphogenesis and block invasion of prostate cancer cells in three-dimensional organotypic models.
Härmä V, Knuuttila M, Virtanen J, Mirtti T, Kohonen P, Kovanen P, Happonen A, Kaewphan S, Ahonen I, Kallioniemi O, Grafström R, Lötjönen J, Nees M
Oncogene 2012 Apr 19;31(16):2075-89
Oncogene 2012 Apr 19;31(16):2075-89
No comments: Submit comment
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Recombinant expression validation
- Main image
- Experimental details
- Western blot analysis in control (vector only transfected HEK293T lysate) and ARHGEF11 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY404959).
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Independent antibody validation
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex, colon, lymph node and testis using Anti-ARHGEF11 antibody HPA011026 (A) shows similar protein distribution across tissues to independent antibody HPA012037 (B).
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human rectum shows strong cytoplasmic positivity in glandular cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis using Anti-ARHGEF11 antibody HPA011026.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human colon using Anti-ARHGEF11 antibody HPA011026.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human lymph node using Anti-ARHGEF11 antibody HPA011026.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex using Anti-ARHGEF11 antibody HPA011026.
- Sample type
- HUMAN
