Explore
Validate
Learn
ImmunohistochemistryAntibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Immunohistochemistry [7]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA031634 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA031634, RRID:AB_10603021
- Product name
- Anti-MUC17
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
NPTSTPTVPRTTTCFGDGCQNTASRCKNGGTWDGL
KCQCPNLYYGELCEEVVSSIDIGPPETISAQMELT
VTVTSVKFTEELKNHSSQEFQEFKQTFTEQMNIVY
SGIPEYVGVNITKLRLGSVVVEHDVLLRTKYTPEY
K- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Identification of PAM4 (clivatuzumab)-reactive epitope on MUC5AC: a promising biomarker and therapeutic target for pancreatic cancer.
RNA sequencing of sessile serrated colon polyps identifies differentially expressed genes and immunohistochemical markers.
Cystic fibrosis and the relationship between mucin and chloride secretion by cultures of human airway gland mucous cells.
Liu D, Chang CH, Gold DV, Goldenberg DM
Oncotarget 2015 Feb 28;6(6):4274-85
Oncotarget 2015 Feb 28;6(6):4274-85
RNA sequencing of sessile serrated colon polyps identifies differentially expressed genes and immunohistochemical markers.
Delker DA, McGettigan BM, Kanth P, Pop S, Neklason DW, Bronner MP, Burt RW, Hagedorn CH
PloS one 2014;9(2):e88367
PloS one 2014;9(2):e88367
Cystic fibrosis and the relationship between mucin and chloride secretion by cultures of human airway gland mucous cells.
Finkbeiner WE, Zlock LT, Morikawa M, Lao AY, Dasari V, Widdicombe JH
American journal of physiology. Lung cellular and molecular physiology 2011 Oct;301(4):L402-14
American journal of physiology. Lung cellular and molecular physiology 2011 Oct;301(4):L402-14
No comments: Submit comment
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human small intestine and fallopian tube tissues using HPA031634 antibody. Corresponding MUC17 RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human small intestine shows high expression.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human liver shows low expression as expected.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human colon shows weak cytoplasmic positivity in glandular cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human duodenum shows moderate membranous positivity in glandular cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human small intestine shows moderate membranous positivity in glandular cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human fallopian tube shows no positivity in glandular cells as expected.
- Sample type
- HUMAN
