Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00006096-M08 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00006096-M08, RRID:AB_566145
- Product name
- RORB monoclonal antibody (M08), clone 1E5
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant RORB.
- Antigen sequence
ETSGTYANGHVIDLPKSEGYYNVDSGQPSPDQSGL
DMTGIKQIKQEPIYDLTSVPNLFTYSSFNNGQLAP
GITMTEIDRIAQNIIKSHL- Isotype
- IgG
- Antibody clone number
- 1E5
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of RORB expression in transfected 293T cell line by RORB monoclonal antibody (M08), clone 1E5.Lane 1: RORB transfected lysate (Predicted MW: 52.1 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged RORB is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol