Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunoprecipitation [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00028999-M02 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00028999-M02, RRID:AB_1576661
- Product name
- KLF15 monoclonal antibody (M02), clone 1F3
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant KLF15.
- Antigen sequence
MVDHLLPVDENFSSPKCPVGYLGDRLVGRRAYHML
PSPVSEDDSDASSPCSCSSPDSQALCSCYGGGLGT
ESQDSILD- Isotype
- IgG
- Antibody clone number
- 1F3
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of KLF15 expression in transfected 293T cell line by KLF15 monoclonal antibody (M02), clone 1F3.Lane 1: KLF15 transfected lysate(44 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged KLF15 is 1 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoprecipitation of KLF15 transfected lysate using anti-KLF15 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with KLF15 MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol