HPA021773

antibody from Atlas Antibodies

Targeting: CBLL1 FLJ23109, HAKAI, RNF188

Antibody data

Submit

Validation data

Product number: HPA021773 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA021773, RRID:AB_1846103
Product name: Anti-CBLL1
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: RKHSNLITVPIQDDSNSGAREPPPPAPAPAHHHPE YQGQPVVSHPHHIMPPQQHYAPPPPPPPPISHPMP
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

CBLL1 protein structure - HPA021773 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex, colon, placenta and testis using Anti-CBLL1 antibody HPA021773 (A) shows similar protein distribution across tissues to independent antibody HPA026699 (B).
Antibody #2 product nr: HPA026699
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebellum shows strong nuclear positivity in Purkinje cells, cells in molecular layer and cells in granular layer.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon using Anti-CBLL1 antibody HPA021773.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis using Anti-CBLL1 antibody HPA021773.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human placenta using Anti-CBLL1 antibody HPA021773.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex using Anti-CBLL1 antibody HPA021773.
Sample type: HUMAN