HPA006669

antibody from Atlas Antibodies

Targeting: BCLAF1 BTF, KIAA0164

Antibody data

Submit

Validation data

Product number: HPA006669 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA006669, RRID:AB_1078302
Product name: Anti-BCLAF1
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: LLDRGNTRDKEASKEKGSEKGRAEGEWEDQEALDY FSDKESGKQKFNDSEGDDTEETEDYRQFRKSVLAD QGKSFATASHRNTEEEGLKYKSKVSLKGNRESDGF REEKNYKLKETGYVVERPSTTKDKHKEED
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

BCLAF1 protein structure - HPA006669 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human bone marrow, cerebral cortex, colon and kidney using Anti-BCLAF1 antibody HPA006669 (A) shows similar protein distribution across tissues to independent antibody HPA027770 (B).
Antibody #2 product nr: HPA027770
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human bone marrow shows strong nuclear positivity in hematopoietic cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex using Anti-BCLAF1 antibody HPA006669.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon using Anti-BCLAF1 antibody HPA006669.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human bone marrow using Anti-BCLAF1 antibody HPA006669.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney using Anti-BCLAF1 antibody HPA006669.
Sample type: HUMAN