HPA053128

antibody from Atlas Antibodies

Targeting: AHCYL2 IRBIT2, KIAA0828, long-IRBIT

Antibody data

Submit

Validation data

Product number: HPA053128 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA053128, RRID:AB_2682050
Product name: Anti-AHCYL2
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: GKVPQASAMKRSDPHHQHQRHRDGGEALVSPDGTV TEAPRTVKKQIQFADQKQEFNKRPTKI
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

AHCYL2 protein structure - HPA053128 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human stomach and liver tissues using HPA053128 antibody. Corresponding AHCYL2 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human stomach, upper shows strong membranous positivity in glandular cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human small intestine shows weak cytoplasmic positivity in glandular cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex shows weak to moderate cytoplasmic positivity in neurons.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver shows no positivity in hepatocytes as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human stomach shows moderate to strong membranous positivity in parietal cells.
Sample type: HUMAN