Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN310520 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Solute Carrier Family 35, Member B1 (SLC35B1) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-SLC35B1 antibody: synthetic peptide directed towards the C terminal of human SLC35B1
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
ALGQSFIFMTVVYFGPLTCSIITTTRKFFTILASV
ILFAN PISPMQWVGT- Epitope
- C-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Molecular cloning and characterization of a novel isoform of the human UDP-galactose transporter, and of related complementary DNAs belonging to the nucleotide-sugar transporter gene family.
Ishida N, Miura N, Yoshioka S, Kawakita M
Journal of biochemistry 1996 Dec;120(6):1074-8
Journal of biochemistry 1996 Dec;120(6):1074-8
No comments: Submit comment
No validations: Submit validation data