Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN183172 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Bestrophin 4 (BEST4) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-VMD2L2 antibody: synthetic peptide directed towards the N terminal of human VMD2L2
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian
- Host
- Rabbit
- Antigen sequence
MTVSYTLKVAEARFGGFSGLLLRWRGSIYKLLYKE
FLLFG ALYAVLSITY- Epitope
- N-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Functional assembly and purinergic activation of bestrophins.
Three novel human VMD2-like genes are members of the evolutionary highly conserved RFP-TM family.
Milenkovic VM, Soria RB, Aldehni F, Schreiber R, Kunzelmann K
Pflugers Archiv : European journal of physiology 2009 Jun;458(2):431-41
Pflugers Archiv : European journal of physiology 2009 Jun;458(2):431-41
Three novel human VMD2-like genes are members of the evolutionary highly conserved RFP-TM family.
Stöhr H, Marquardt A, Nanda I, Schmid M, Weber BH
European journal of human genetics : EJHG 2002 Apr;10(4):281-4
European journal of human genetics : EJHG 2002 Apr;10(4):281-4
No comments: Submit comment
No validations: Submit validation data