Explore
Validate
Learn
Western blot
ImmunocytochemistryAntibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA017284 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA017284, RRID:AB_1857775
- Product name
- Anti-TARDBP
- Antibody type
- Polyclonal
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
VTFADDQIAQSLCGEDLIIKGISVHISNAEPKHNS
NRQLERSGRFGGNPGGFGNQGGFGNSRGGGAGLGN
NQGSNMGGGMNFGAFSINPAMMAAAQAALQSSWGM
MGMLASQQNQSGPSGNNQNQGNMQREPNQAFGSGN
N- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells
Cancer cell response to anthracyclines effects: mysteries of the hidden proteins associated with these drugs.
CSPα promotes SNARE-complex assembly by chaperoning SNAP-25 during synaptic activity
Stadler C, Rexhepaj E, Singan V, Murphy R, Pepperkok R, Uhlén M, Simpson J, Lundberg E
Nature Methods 2013 February;10(4):315-323
Nature Methods 2013 February;10(4):315-323
Cancer cell response to anthracyclines effects: mysteries of the hidden proteins associated with these drugs.
Tyleckova J, Hrabakova R, Mairychova K, Halada P, Radova L, Dzubak P, Hajduch M, Gadher SJ, Kovarova H
International journal of molecular sciences 2012 Nov 22;13(12):15536-64
International journal of molecular sciences 2012 Nov 22;13(12):15536-64
CSPα promotes SNARE-complex assembly by chaperoning SNAP-25 during synaptic activity
Sharma M, Burré J, Südhof T
Nature Cell Biology 2010 December;13(1):30-39
Nature Cell Biology 2010 December;13(1):30-39
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human epididymis shows distinct positivity in both nuclei and cytoplasm of glandular cells.
- Sample type
- HUMAN
