Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN182858 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-LIM Homeobox 3 (LHX3) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-LHX3 antibody: synthetic peptide directed towards the middle region of human LHX3
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Bovine, Canine, Chicken/Avian, Porcine, Xenopus
- Host
- Rabbit
- Antigen sequence
QNRRAKEKRLKKDAGRQRWGQYFRNMKRSRGGSKS
DKDSV QEGQDSDAEV- Epitope
- Middle Region
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Trends of selected malformations in relation to folic acid recommendations and fortification: an international assessment.
Borjeson-Forssman-Lehmann syndrome: a novel pituitary phenotype due to mutation in a novel gene.
Botto LD, Lisi A, Bower C, Canfield MA, Dattani N, De Vigan C, De Walle H, Erickson DJ, Halliday J, Irgens LM, Lowry RB, McDonnell R, Metneki J, Poetzsch S, Ritvanen A, Robert-Gnansia E, Siffel C, Stoll C, Mastroiacovo P
Birth defects research. Part A, Clinical and molecular teratology 2006 Oct;76(10):693-705
Birth defects research. Part A, Clinical and molecular teratology 2006 Oct;76(10):693-705
Borjeson-Forssman-Lehmann syndrome: a novel pituitary phenotype due to mutation in a novel gene.
Dattani MT
Journal of pediatric endocrinology & metabolism : JPEM 2003 Dec;16(9):1207-9
Journal of pediatric endocrinology & metabolism : JPEM 2003 Dec;16(9):1207-9
No comments: Submit comment
No validations: Submit validation data