Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunoprecipitation [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00010061-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00010061-M01, RRID:AB_425827
- Product name
- ABCF2 monoclonal antibody (M01), clone 1D11
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant ABCF2.
- Antigen sequence
MPSDLAKKKAAKKKEAAKARQRPRKGHEENGDVVT
EPQVAEKNEANGRETTEVDLLTKELEDFEMKKAAA
RAVTGVLASHPNSTDVHIINLSLTFHGQELLSDTK
LELNS- Isotype
- IgG
- Antibody clone number
- 1D11
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- ABCF2 monoclonal antibody (M01), clone 1D11 Western Blot analysis of ABCF2 expression in Hela ( Cat # L013V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of ABCF2 expression in transfected 293T cell line by ABCF2 monoclonal antibody (M01), clone 1D11.Lane 1: ABCF2 transfected lysate(68.53 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged ABCF2 is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoprecipitation of ABCF2 transfected lysate using anti-ABCF2 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with ABCF2 monoclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to ABCF2 on formalin-fixed paraffin-embedded human prostate. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol