Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [2]
- Immunoprecipitation [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00002810-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00002810-M01, RRID:AB_425459
- Product name
- SFN monoclonal antibody (M01), clone 3C3
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant SFN.
- Antigen sequence
MERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEE
LSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSN
EEGSEEKGPEVREYREKAETELQGVCDTVLGLLDS
HLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDK
KRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALN
FSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSE
DSYKDSTLIMQLLRDNLTLWTADNAGEEGGEAPQE
PQS- Isotype
- IgG
- Antibody clone number
- 3C3
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references An inverse switch in DNA base excision and strand break repair contributes to melphalan resistance in multiple myeloma cells.
Sousa MM, Zub KA, Aas PA, Hanssen-Bauer A, Demirovic A, Sarno A, Tian E, Liabakk NB, Slupphaug G
PloS one 2013;8(2):e55493
PloS one 2013;8(2):e55493
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- SFN monoclonal antibody (M01), clone 3C3 Western Blot analysis of SFN expression in HeLa ( Cat # L013V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of SFN expression in transfected 293T cell line by SFN monoclonal antibody (M01), clone 3C3.Lane 1: SFN transfected lysate(27.8 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoprecipitation of SFN transfected lysate using anti-SFN monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with SFN MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to SFN on formalin-fixed paraffin-embedded human uterine cervix tissue. [antibody concentration 5 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol