Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [2]
- Immunocytochemistry [1]
- Immunohistochemistry [5]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA029971 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA029971, RRID:AB_10611389
- Product name
- Anti-RECQL5
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
ELEHETFRNAKVANLYKASVLKKVADIHRASKDGQ
PYDMGGSAKSCSAQAEPPEPNEYDIPPASHVYSLK
PKRVGAGFPKGSCPFQTATELMETTRIREQ- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells
Altered RECQ Helicase Expression in Sporadic Primary Colorectal Cancers.
Stadler C, Rexhepaj E, Singan V, Murphy R, Pepperkok R, Uhlén M, Simpson J, Lundberg E
Nature Methods 2013 February;10(4):315-323
Nature Methods 2013 February;10(4):315-323
Altered RECQ Helicase Expression in Sporadic Primary Colorectal Cancers.
Lao VV, Welcsh P, Luo Y, Carter KT, Dzieciatkowski S, Dintzis S, Meza J, Sarvetnick NE, Monnat RJ Jr, Loeb LA, Grady WM
Translational oncology 2013 Aug;6(4):458-69
Translational oncology 2013 Aug;6(4):458-69
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Genetic validation
- Main image
- Experimental details
- Western blot analysis in A-549 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-RECQL5 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Western blot analysis in human cell line A-549.
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line A-431 shows localization to nucleus & cytosol.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human placenta shows no positivity in stromal cells as expected.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis shows moderate to strong nuclear positivity in squamous epithelial cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex shows moderate to strong nuclear positivity in neurons.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cervix, uterine shows moderate to strong nuclear positivity in squamous epithelial cells.
- Sample type
- HUMAN