Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN501799 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Zinc Finger Protein 446 (ZNF446) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ZNF446 antibody: synthetic peptide directed towards the N terminal of human ZNF446
- Description
- Affinity Purified
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
MPSPLGPPCLPVMDPETTLEEPETARLRFRGFCYQ
EVAGP REALARLREL- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references A novel human KRAB-containing zinc-finger gene ZNF446 inhibits transcriptional activities of SRE and AP-1.
Liu F, Zhu C, Xiao J, Wang Y, Tang W, Yuan W, Zhao Y, Li Y, Xiang Z, Wu X, Liu M
Biochemical and biophysical research communications 2005 Jul 22;333(1):5-13
Biochemical and biophysical research communications 2005 Jul 22;333(1):5-13
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting