Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN501910 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Oligodendrocyte Transcription Factor 3 (OLIG3) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-OLIG3 antibody: synthetic peptide directed towards the N terminal of human OLIG3
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Canine, Chicken/Avian, Zebrafish
- Host
- Rabbit
- Antigen sequence
MNSDSSSVSSRASSPDMDEMYLRDHHHRHHHHQES
RLNSV SSTQGDMMQK- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Two independent alleles at 6q23 associated with risk of rheumatoid arthritis.
Plenge RM, Cotsapas C, Davies L, Price AL, de Bakker PI, Maller J, Pe'er I, Burtt NP, Blumenstiel B, DeFelice M, Parkin M, Barry R, Winslow W, Healy C, Graham RR, Neale BM, Izmailova E, Roubenoff R, Parker AN, Glass R, Karlson EW, Maher N, Hafler DA, Lee DM, Seldin MF, Remmers EF, Lee AT, Padyukov L, Alfredsson L, Coblyn J, Weinblatt ME, Gabriel SB, Purcell S, Klareskog L, Gregersen PK, Shadick NA, Daly MJ, Altshuler D
Nature genetics 2007 Dec;39(12):1477-82
Nature genetics 2007 Dec;39(12):1477-82
No comments: Submit comment
No validations: Submit validation data