Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA007610 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA007610, RRID:AB_1852006
- Product name
- Anti-KDM4A
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
DVFVRKFQPERYKLWKAGKDNTVIDHTLPTPEAAE
FLKESELPPRAGNEEECPEEDMEGVEDGEEGDLKT
SLAKHRIGTKRHRVCLEIPQEVSQSELFPKEDLSS
EQYEMTEC- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references FBXO22 protein is required for optimal synthesis of the N-methyl-D-aspartate (NMDA) receptor coagonist D-serine.
A new isoform of the histone demethylase JMJD2A/KDM4A is required for skeletal muscle differentiation.
Dikopoltsev E, Foltyn VN, Zehl M, Jensen ON, Mori H, Radzishevsky I, Wolosker H
The Journal of biological chemistry 2014 Dec 5;289(49):33904-15
The Journal of biological chemistry 2014 Dec 5;289(49):33904-15
A new isoform of the histone demethylase JMJD2A/KDM4A is required for skeletal muscle differentiation.
Verrier L, Escaffit F, Chailleux C, Trouche D, Vandromme M
PLoS genetics 2011 Jun;7(6):e1001390
PLoS genetics 2011 Jun;7(6):e1001390
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleoli.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts.
- Sample type
- HUMAN