Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunoprecipitation [1]
- Proximity ligation assay [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00007855-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00007855-M01, RRID:AB_509145
- Product name
- FZD5 monoclonal antibody (M01), clone 6A3
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant FZD5.
- Antigen sequence
PLVEIQCSPDLRFFLCSMYTPICLPDYHKPLPPCR
SVCERAKAGCSPLMRQYGFAWPERMSCDRLPVLGR
DAEVLCMDYNRSEATTAPPR- Isotype
- IgG
- Antibody clone number
- 6A3
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of FZD5 expression in transfected 293T cell line by FZD5 monoclonal antibody (M01), clone 6A3.Lane 1: FZD5 transfected lysate(64.5 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged FZD5 is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoprecipitation of FZD5 transfected lysate using anti-FZD5 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with FZD5 MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Proximity Ligation Analysis of protein-protein interactions between WNT5A and FZD5. HeLa cells were stained with anti-WNT5A rabbit purified polyclonal 1:1200 and anti-FZD5 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
- Validation comment
- In situ Proximity Ligation Assay (Cell)