HPA057763

antibody from Atlas Antibodies

Targeting: CD101 IGSF2, V7

Antibody data

Submit

Validation data

Product number: HPA057763 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA057763, RRID:AB_2683519
Product name: Anti-CD101
Antibody type: Polyclonal
Description: Affinity purified using the PrEST antigen as affinity ligand
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: NSRSQVQELSINSNTDIECSILSRSNGNLQLAIIW YFSPVSTNASWLKILEMDQTNVIKTGDEFHTPQRK QKFHTEKVSQD
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

CD101 protein structure - HPA057763 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human lung and liver tissues using HPA057763 antibody. Corresponding CD101 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human small intestine shows strong positivity in a subset of leukocytes.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lung shows moderate cytoplasmic positivity in macrophages.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human small intestine shows moderate cytoplasmic positivity in lymphoid cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human tonsil shows moderate cytoplasmic positivity in lymphoid cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver shows very weak cytoplasmic positivity in hepatocytes.
Sample type: HUMAN