Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA030088 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA030088, RRID:AB_10601106
- Product name
- Anti-LMX1A
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
QRAKMKKLARRQQQQQQDQQNTQRLSSAQTNGGGS
AGMEGIMNPYTALPTPQQLLAIEQSVYSSDPFRQG
LT- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Dopaminergic control of autophagic-lysosomal function implicates Lmx1b in Parkinson's disease
Laguna A, Schintu N, Nobre A, Alvarsson A, Volakakis N, Jacobsen J, Gómez-Galán M, Sopova E, Joodmardi E, Yoshitake T, Deng Q, Kehr J, Ericson J, Svenningsson P, Shupliakov O, Perlmann T
Nature Neuroscience 2015 April;18(6):826-835
Nature Neuroscience 2015 April;18(6):826-835
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & the Golgi apparatus.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human duodenum shows strong granular cytoplasmic positivity in glandular cells.