HPA026304

antibody from Atlas Antibodies

Targeting: CAMSAP2 CAMSAP1L1, KIAA1078

Antibody data

Submit

Validation data

Product number: HPA026304 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA026304, RRID:AB_1852376
Product name: Anti-CAMSAP2
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: SSVHGVSFDISFDKEDSVQRSTPNRGITRSISNEG LTLNNSHVSKHIRKNLSFKPINGEEEAESIEEELN IDSHSDLKSCVPL
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

CAMSAP2 protein structure - HPA026304 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex, colon, lymph node and testis using Anti-CAMSAP2 antibody HPA026304 (A) shows similar protein distribution across tissues to independent antibody HPA026511 (B).
Antibody #2 product nr: HPA026511, HPA027302
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis using Anti-CAMSAP2 antibody HPA026304.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex using Anti-CAMSAP2 antibody HPA026304.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon using Anti-CAMSAP2 antibody HPA026304.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lymph node using Anti-CAMSAP2 antibody HPA026304.
Sample type: HUMAN