HPA024594

antibody from Atlas Antibodies

Targeting: IARS2 FLJ10326

Antibody data

Submit

Validation data

Product number: HPA024594 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA024594, RRID:AB_1851368
Product name: Anti-IARS2
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: VASQHNLPMDCLVDEDGVFTDVAGPELQNKAVLEE GTDVVIKMLQTAKNLLKEEKLVHSYPYDWRTKKPV VIRASKQWFINITDIKTA
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

IARS2 protein structure - HPA024594 shown in red.

Enhanced validation

Submitted by: klas2
Enhanced method: Genetic validation
Main image
Experimental details: Western blot of cell lysate from U-2 OS cells transfected with either siRNA targeting IARS2 or control siRNA. Lane 1: Marker (250, 130, 95, 72, 55, 36, 28, 17, 10) Lane 2: Cell lysate from U-2OS cells transfected with siRNA targeting IARS2 Lane 3: N/A Lane 4: Cell lysate from U-2OS cells transfected with control siRNA Right image, lane 1-4: loading control
Sample type: U-2 OS
Primary Ab dilution: 1:569
Conjugate: Horseradish Peroxidase
Secondary Ab: Secondary Ab
Secondary Ab dilution: 1:3000
Knockdown/Genetic Approaches Application: Western blot
KD Reagent Type: siRNA
Downregulation: >75%
KD Reagent Prod page: KD Reagent Prod page
KD Reagent Prod no: s31281
KD Reagent Provider: Thermo Fisher Scientific
KD Reagent Prod no 2: s31282
KD Reagent Page 2: KD Reagent Page 2
KD Reagent Prod no 3: s31283
KD Reagent Page 3: KD Reagent Page 3
Antibody Lot Number: R12570
Appendix: 566d58e20fc88.pdf

Supportive validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Western blot analysis using Anti-IARS2 antibody HPA024594 (A) shows similar pattern to independent antibody HPA024212 (B).
Antibody #2 product nr: HPA024212, HPA024596
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp