Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Immunohistochemistry [5]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA007459 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA007459, RRID:AB_1079828
- Product name
- Anti-ROCK2
- Antibody type
- Polyclonal
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
FVGNQLPFIGFTYYRENLLLSDSPSCRETDSIQSR
KNEESQEIQKKLYTLEEHLSNEMQAKEELEQKCKS
VNTRLEKTAKELEEEITLRKSVESALRQLEREKAL
LQHKNAEYQRKADHEADK- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Inhibition of Rho-associated kinases disturbs the collective cell migration of stratified TE-10 cells.
Novel signatures of cancer-associated fibroblasts
Mikami T, Yoshida K, Sawada H, Esaki M, Yasumura K, Ono M
Biological research 2015 Sep 2;48(1):48
Biological research 2015 Sep 2;48(1):48
Novel signatures of cancer-associated fibroblasts
Bozóky B, Savchenko A, Csermely P, Korcsmáros T, Dúl Z, Pontén F, Székely L, Klein G
International Journal of Cancer 2013 July;133(2):286-293
International Journal of Cancer 2013 July;133(2):286-293
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human stomach shows strong cytoplasmic positivity in glandular cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human liver shows no positivity in hepatocytes as expected.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human colorectal cancer shows strong cytoplasmic positivity in tumor cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human stomach shows strong cytoplasmic positivity in glandular cells.
- Sample type
- HUMAN