Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA008162 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA008162, RRID:AB_1855122
- Product name
- Anti-PDE4DIP
- Antibody type
- Polyclonal
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
DVLSSNEATMQSMESLLRAKGLEVEQLSTTCQNLQ
WLKEEMETKFSRWQKEQESIIQQLQTSLHDRNKEV
EDLSATLLCKLGPGQSEIAEELCQRLQRKERMLQD
LLSDRNKQVLEHEMEIQGLLQSVSTREQESQAAA- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Myomegalin is necessary for the formation of centrosomal and Golgi-derived microtubules.
Roubin R, Acquaviva C, Chevrier V, Sedjaï F, Zyss D, Birnbaum D, Rosnet O
Biology open 2013 Feb 15;2(2):238-50
Biology open 2013 Feb 15;2(2):238-50
No comments: Submit comment
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Western blot analysis in human cell lines U-251MG and A-549 using Anti-PDE4DIP antibody. Corresponding PDE4DIP RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human rectum shows strong cytoplasmic positivity in glandular cells.
- Sample type
- HUMAN