Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN311651 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-rho GTPase Activating Protein 28 (ARHGAP28) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ARHGAP28 antibody: synthetic peptide directed towards the C terminal of human ARHGAP28
- Description
- Affinity Purified
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
AKFQYENRILHWQRAALSFLNGKWVKKEREESTET
NRSPK HVFLFTIGLD- Epitope
- C-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references DNA sequence and analysis of human chromosome 18.
Nusbaum C, Zody MC, Borowsky ML, Kamal M, Kodira CD, Taylor TD, Whittaker CA, Chang JL, Cuomo CA, Dewar K, FitzGerald MG, Yang X, Abouelleil A, Allen NR, Anderson S, Bloom T, Bugalter B, Butler J, Cook A, DeCaprio D, Engels R, Garber M, Gnirke A, Hafez N, Hall JL, Norman CH, Itoh T, Jaffe DB, Kuroki Y, Lehoczky J, Lui A, Macdonald P, Mauceli E, Mikkelsen TS, Naylor JW, Nicol R, Nguyen C, Noguchi H, O'Leary SB, O'Neill K, Piqani B, Smith CL, Talamas JA, Topham K, Totoki Y, Toyoda A, Wain HM, Young SK, Zeng Q, Zimmer AR, Fujiyama A, Hattori M, Birren BW, Sakaki Y, Lander ES
Nature 2005 Sep 22;437(7058):551-5
Nature 2005 Sep 22;437(7058):551-5
No comments: Submit comment
No validations: Submit validation data