HPA036493

antibody from Atlas Antibodies

Targeting: SLC9A3 NHE3

Antibody data

Submit

Validation data

Product number: HPA036493 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA036493, RRID:AB_10673353
Product name: Anti-SLC9A3
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: TDNVVNVDFTPRSSTVEASVSYLLRENVSAVCLDM QSLEQRRRSIRDAEDMVTHHTLQQYLYKPRQEYKH LYSRHELTPTEDEKQDREIFHRTM
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

SLC9A3 protein structure - HPA036493 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human colon and liver tissues using Anti-SLC9A3 antibody. Corresponding SLC9A3 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex, colon, gallbladder and lymph node using Anti-SLC9A3 antibody HPA036493 (A) shows similar protein distribution across tissues to independent antibody HPA036669 (B).
Antibody #2 product nr: HPA036669
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human small intestine shows strong membranous positivity in glandular cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lymph node using Anti-SLC9A3 antibody HPA036493.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human gallbladder using Anti-SLC9A3 antibody HPA036493.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex using Anti-SLC9A3 antibody HPA036493.
Sample type: HUMAN