Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA037986 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA037986, RRID:AB_10673035
- Product name
- Anti-CELF4
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
MYIKMATLANGQADNASLSTNGLGSSPGSAGHMNG
LSHSPGNPSTIPMKDH- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Aberrant sodium channel activity in the complex seizure disorder of Celf4 mutant mice.
CELF4 regulates translation and local abundance of a vast set of mRNAs, including genes associated with regulation of synaptic function.
Sun W, Wagnon JL, Mahaffey CL, Briese M, Ule J, Frankel WN
The Journal of physiology 2013 Jan 1;591(1):241-55
The Journal of physiology 2013 Jan 1;591(1):241-55
CELF4 regulates translation and local abundance of a vast set of mRNAs, including genes associated with regulation of synaptic function.
Wagnon JL, Briese M, Sun W, Mahaffey CL, Curk T, Rot G, Ule J, Frankel WN
PLoS genetics 2012;8(11):e1003067
PLoS genetics 2012;8(11):e1003067
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.
- Sample type
- HUMAN