HPA039526

antibody from Atlas Antibodies

Targeting: ATP12A ATP1AL1, H-K-ATPase, HK

Western blot

Antibody data

Submit

Validation data

Product number: HPA039526 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA039526, RRID:AB_10673534
Product name: Anti-ATP12A
Antibody type: Polyclonal
Description: Affinity purified using the PrEST antigen as affinity ligand
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: IYSVELSGTKDIVKTDKGDGKEKYRGLKNNCLELK KKNHKEEFQKELHLDDHKLSNRELEEKYGTDIIMG LSSTR
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

ATP12A protein structure - HPA039526 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human kidney and skeletal muscle tissues using HPA039526 antibody. Corresponding ATP12A RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney shows strong membranous positivity in cells in tubules.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney shows strong positivity in apical membrane in cells in collecting ducts.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human tonsil shows strong membranous positivity in squamous epithelial cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skeletal muscle shows no positivity in striated muscle fibers as expected.
Sample type: HUMAN