Explore
Validate
LearnPAB20538
antibody from Abnova Corporation
Targeting: PLGRKT
AD025, C9orf46, FLJ14688, MDS030, Plg-RKT
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB20538 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#PAB20538, RRID:AB_10963592
- Product name
- C9orf46 polyclonal antibody
- Antibody type
- Polyclonal
- Antigen
- Recombinant protein corresponding to amino acids of human C9orf46.
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Antigen sequence
KKPAFLVPIVPLSFILTYQYDLGYGTLLERMKGEA
EDILETEKSKLQLPRGMITFESIEKARKEQSRFFI
DK- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: Human Plasma, Lane 4: Liver, Lane 5: Tonsil with C9orf46 polyclonal antibody (Cat # PAB20538) at 1:250-1:500 dilution.
- Validation comment
- Western Blot
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western blot analysis of cell lysates with C9orf46 polyclonal antibody (Cat # PAB20538) at 1:250-1:500 dilution.Lane 1 : NIH/3T3Lane 2 : NBT-II
- Validation comment
- Western Blot (Cell lysate)
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human liver with C9orf46 polyclonal antibody (Cat # PAB20538) shows strong cytoplasmic positivity with a granular pattern in hepatocytes at 1:200-1:500 dilution.
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
