HPA059005

antibody from Atlas Antibodies

Targeting: PITPNM3 ACKR6, CORD5, NIR1, RDGBA3

Antibody data

Submit

Validation data

Product number: HPA059005 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA059005, RRID:AB_2683876
Product name: Anti-PITPNM3
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: DLVEQIETMGKLDEHQGEGTAPCTSSILQEKQREL YRVSLRRQRFPAQGSIEIHEDSEEGCPQRSCKTHV
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

PITPNM3 protein structure - HPA059005 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human spleen and pancreas tissues using Anti-PITPNM3 antibody. Corresponding PITPNM3 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex, kidney, liver and spleen using Anti-PITPNM3 antibody HPA059005 (A) shows similar protein distribution across tissues to independent antibody HPA022432 (B).
Antibody #2 product nr: HPA022432
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human spleen shows distinct positivity in sinusoids.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human spleen shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human pancreas shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney using Anti-PITPNM3 antibody HPA059005.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex using Anti-PITPNM3 antibody HPA059005.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver using Anti-PITPNM3 antibody HPA059005.
Sample type: HUMAN