Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN635090 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Ras Homolog Gene Family, Member T1 (RHOT1) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- RHOT1 antibody was raised using the N terminal of RHOT1 corresponding to a region with amino acids EMKPACIKALTRIFKISDQDNDGTLNDAELNFFQRICFNTPLAPQALEDV
- Description
- Affinity purified
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1 mg/mL
- Storage
- Store at 2-8°C for short periods. For longer periods of storage, store at -20°C.
- Handling
- Avoid repeated freeze/thaw cycles. Dilute only prior to immediate use.
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- RHOT1 antibody used at 1 ug/ml to detect target protein.
- Validation comment
- WB
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Independently validated image of Western Blot analysis
- Validation comment
- WB
