Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Immunohistochemistry [6]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA029578 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA029578, RRID:AB_10602423
- Product name
- Anti-HGSNAT
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
QALLLIHNELLWTNLTVYWKSECCYHCLFQVLVNV
PQSPKAGKPSAAAASVSTQHGSILQLNDTLEEKEV
CRLEYRFGEFGNYSLLVKNIHNGVSEIACDLAVN- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Therapeutic strategies based on modified U1 snRNAs and chaperones for Sanfilippo C splicing mutations.
Matos L, Canals I, Dridi L, Choi Y, Prata MJ, Jordan P, Desviat LR, PĂ©rez B, Pshezhetsky AV, Grinberg D, Alves S, Vilageliu L
Orphanet journal of rare diseases 2014 Dec 10;9:180
Orphanet journal of rare diseases 2014 Dec 10;9:180
No comments: Submit comment
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human fallopian tube and skeletal muscle tissues using HPA029578 antibody. Corresponding HGSNAT RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human prostate shows strong granular cytoplasmic positivity in glandular cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human placenta shows strong membranous positivity in trophoblastic cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human Fallopian tube shows strong membranous positivity in glandular cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human skeletal muscle shows very weak positivity in myocytes as expected.
- Sample type
- HUMAN