Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00079365-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00079365-M01, RRID:AB_605978
- Product name
- BHLHB3 monoclonal antibody (M01), clone 4H6
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant BHLHB3.
- Antigen sequence
CLERAGQKLEPLAYCVPVIQRTQPSAELAAENDTD
TDSGYGGEAEARPDREKGKGAGASRVTIKQEPPGE
DSPAPKRMKL- Isotype
- IgG
- Antibody clone number
- 4H6
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references A new role for sterol regulatory element binding protein 1 transcription factors in the regulation of muscle mass and muscle cell differentiation.
Lecomte V, Meugnier E, Euthine V, Durand C, Freyssenet D, Nemoz G, Rome S, Vidal H, Lefai E
Molecular and cellular biology 2010 Mar;30(5):1182-98
Molecular and cellular biology 2010 Mar;30(5):1182-98
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged BHLHE41 is 1 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to BHLHE41 on HeLa cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol