Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00010045-M04 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00010045-M04, RRID:AB_1137445
- Product name
- SH2D3A monoclonal antibody (M04), clone 3B11
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant SH2D3A.
- Antigen sequence
GAGPCDPGEVALPHVAPMVRLLEGEEVAGPLDESC
ERLLRTLHGARHMVRDAPKFRKVAAQRLRGFRPNP
ELREALTTGFVRRLLWGSRGAGAPRAERFEKFQRV
LGVLSQRLEPD- Isotype
- IgG
- Antibody clone number
- 3B11
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of SH2D3A expression in transfected 293T cell line by SH2D3A monoclonal antibody (M04), clone 3B11.Lane 1: SH2D3A transfected lysate(63.1 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged SH2D3A is approximately 1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to SH2D3A on HeLa cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol