102-PA50AG

antibody from ReliaTech GmbH

Targeting: LYVE1 LYVE-1, XLKD1

Western blot (Supportive data in Antibodypedia)

Immunocytochemistry (Recommended by provider)

Immunohistochemistry (Supportive data in Antibodypedia)

Flow cytometry (Supportive data in Antibodypedia)

Antibody Data

Product number

102-PA50AG

Provider

ReliaTech GmbH

Product name

Lyve-1

Antibody type

Polyclonal

Antigen

Recombinant human soluble LYVE-1

Description

antibody affinity purified from serum

Reactivity

Human

Host

Rabbit

Antigen sequence

SLRAEELSIQVSCRIMGITLVSKKANQQLNFTEAK
EACRLLGLSLAGKDQVETALKASFETCSYGWVGDG
FVVISRISPNPKCGKNGVGVLIWKVPVSRQFAAYC
YNSSDTWTNSCIPEIITTKDPIFNTQTATQTTEFI
VSDSTYSVASPYSTIPAPTTTPPAPASTSIPRRKK
LICVTEVFMETSTMSTETEPFVENKAAFKNEAAGH
HHHHH


Antibody clone number

Rabbit IG

Vial size

50 µl

Storage

Store lyophilized at 2-8°C for 6 months or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for one month or (in aliquots) at -20°C long term. Avoid repeated freezing and thawing.

Handling

Restore in sterile water to a concentration of 0.1-1.0 mg/ml. The antibody solution should be gently mixed before use.

References

Submitted references

Novel Blood Vascular Endothelial Subtype-Specific Markers in Human Skin Unearthed by Single-Cell Transcriptomic Profiling.

He Y, Tacconi C, Dieterich LC, Kim J, Restivo G, Gousopoulos E, Lindenblatt N, Levesque MP, Claassen M, Detmar M
Cells 2022 Mar 25;11(7)

---

Stage I-IV Colorectal Cancer Prognosis Can Be Predicted by Type and Number of Intratumoral Macrophages and CLEVER-1⁺ Vessel Density.

Ålgars A, Kemppinen L, Fair-Mäkelä R, Mustonen H, Haglund C, Jalkanen S
Cancers 2021 Nov 28;13(23)

---

Upregulation of VCAM-1 in lymphatic collectors supports dendritic cell entry and rapid migration to lymph nodes in inflammation.

Arasa J, Collado-Diaz V, Kritikos I, Medina-Sanchez JD, Friess MC, Sigmund EC, Schineis P, Hunter MC, Tacconi C, Paterson N, Nagasawa T, Kiefer F, Makinen T, Detmar M, Moser M, Lämmermann T, Halin C
The Journal of experimental medicine 2021 Jul 5;218(7)

---

Absence of lymphatic vessels in term placenta.

Becker J, Tchagou Tchangou GE, Schmidt S, Zelent C, Kahl F, Wilting J
BMC pregnancy and childbirth 2020 Jun 29;20(1):380

---

TGFβ counteracts LYVE-1-mediated induction of lymphangiogenesis by small hyaluronan oligosaccharides

Bauer J, Rothley M, Schmaus A, Quagliata L, Ehret M, Biskup M, Orian-Rousseau V, Jackson D, Pettis R, Harvey A, Bräse S, Thiele W, Sleeman J
Journal of Molecular Medicine 2018 February;96(2):199-209

---

ELM: A New, Simple, and Economic Assay to Measure Motility of Lymphatic Endothelial Cells

Torri F, Dell'Era P, Garrafa E
Lymphatic Research and Biology 2017 March;15(1):39-44

---

Engineering Blood and Lymphatic Microvascular Networks in Fibrin Matrices

Knezevic L, Schaupper M, Mühleder S, Schimek K, Hasenberg T, Marx U, Priglinger E, Redl H, Holnthoner W
Frontiers in Bioengineering and Biotechnology 2017 April;5

---

Orbital Angiogenesis and Lymphangiogenesis in Thyroid Eye Disease

Wong L, Lee N, Amarnani D, Choi C, Bielenberg D, Freitag S, D'Amore P, Kim L
Ophthalmology 2016 September;123(9):2028-2036

---

Fetal liver endothelium regulates the seeding of tissue-resident macrophages

Rantakari P, Jäppinen N, Lokka E, Mokkala E, Gerke H, Peuhu E, Ivaska J, Elima K, Auvinen K, Salmi M
Nature 2016 October;538(7625):392-396

---

Morphological and Molecular Characterization of Human Dermal Lymphatic Collectors

Hasselhof V, Sperling A, Buttler K, Ströbel P, Becker J, Aung T, Felmerer G, Wilting J, Dettman R
PLOS ONE 2016 October;11(10)

---

TGF-β1-induced EMT promotes targeted migration of breast cancer cells through the lymphatic system by the activation of CCR7/CCL21-mediated chemotaxis

Pang M, Georgoudaki A, Lambut L, Johansson J, Tabor V, Hagikura K, Jin Y, Jansson M, Alexander J, Nelson C, Jakobsson L, Betsholtz C, Sund M, Karlsson M, Fuxe J
Oncogene 2016 February;35(6):748-760

---

Generation of pure lymphatic endothelial cells from human pluripotent stem cells and their therapeutic effects on wound repair

Lee S, Park C, Lee J, Kim S, Kwon P, Kim W, Jeon Y, Lee E, Yoon Y
Scientific Reports 2015 September;5(1)

---

The endothelial protein PLVAP in lymphatics controls the entry of lymphocytes and antigens into lymph nodes

Rantakari P, Auvinen K, Jäppinen N, Kapraali M, Valtonen J, Karikoski M, Gerke H, Iftakhar-E-Khuda I, Keuschnigg J, Umemoto E, Tohya K, Miyasaka M, Elima K, Jalkanen S, Salmi M
Nature Immunology 2015 April;16(4):386-396

---

Understanding Lymphatic Drainage Pathways of the Ovaries to Predict Sites for Sentinel Nodes in Ovarian Cancer

Kleppe M, Kraima A, Kruitwagen R, Van Gorp T, Smit N, van Munsteren J, DeRuiter M
International Journal of Gynecological Cancer 2015 ;25(8):1405-1414

---

Lymphangiogenesis and angiogenesis in abdominal aortic aneurysm.

Sano M, Sasaki T, Hirakawa S, Sakabe J, Ogawa M, Baba S, Zaima N, Tanaka H, Inuzuka K, Yamamoto N, Setou M, Sato K, Konno H, Unno N
PloS one 2014;9(3):e89830

---

Lymphangiogenesis and angiogenesis during human fetal pancreas development

Roost M, van Iperen L, de Melo Bernardo A, Mummery C, Carlotti F, de Koning E, Chuva de Sousa Lopes S
Vascular Cell 2014 ;6(1):22

---

Adhesion of Pancreatic Cancer Cells in a Liver-Microvasculature Mimicking Coculture Correlates with Their Propensity to Form Liver-Specific Metastasis

Chowdhury M, Danoy M, Rahman F, Shinohara M, Kaneda S, Shiba K, Fujita N, Fujii T, Sakai Y
BioMed Research International 2014 ;2014

---

High density of peritumoral lymphatic vessels measured by D2-40/podoplanin and LYVE-1 expression in gastric cancer patients: an excellent prognostic indicator or a false friend?

Rudno-Rudzinska J, Kielan W, Grzebieniak Z, Dziegiel P, Donizy P, Mazur G, Knakiewicz M, Frejlich E, Halon A
Gastric Cancer 2013 October;16(4):513-520

---

Lack of Lymphatics and Lymph Node-Mediated Immunity in Choroidal Neovascularization

Nakao S, Zandi S, Kohno R, Sun D, Nakama T, Ishikawa K, Yoshida S, Enaida H, Ishibashi T, Hafezi-Moghadam A
Investigative Ophthalmology & Visual Science 2013 June;54(6):3830-3836

---

Increased lymphatic vessel density and lymphangiogenesis in inflammatory bowel disease

Rahier J, De Beauce S, Dubuquoy L, Erdual E, Colombel J, Jouret-Mourin A, Geboes K, Desreumaux P
Alimentary Pharmacology & Therapeutics 2011 September;34(5):533-543

---

Exercise-induced decline in the density of LYVE-1-positive lymphatic vessels in human skeletal muscle.

Gehlert S, Theis C, Weber S, Schiffer T, Hellmich M, Platen P, Bloch W
Lymphatic research and biology 2010 Sep;8(3):165-73

---

Thymus cell antigen 1 (Thy1, CD90) is expressed by lymphatic vessels and mediates cell adhesion to lymphatic endothelium

Jurisic G, Iolyeva M, Proulx S, Halin C, Detmar M
Experimental Cell Research 2010 October;316(17):2982-2992

---

Vascular Endothelial Growth Factor Receptors VEGFR-2 and VEGFR-3 Are Localized Primarily to the Vasculature in Human Primary Solid Cancers

Smith N, Baker D, James N, Ratcliffe K, Jenkins M, Ashton S, Sproat G, Swann R, Gray N, Ryan A, Jurgensmeier J, Womack C
Clinical Cancer Research 2010 July;16(14):3548-3561

---

An exquisite cross-control mechanism among endothelial cell fate regulators directs the plasticity and heterogeneity of lymphatic endothelial cells

Kang J, Yoo J, Lee S, Tang W, Aguilar B, Ramu S, Choi I, Otu H, Shin J, Dotto G, Koh C, Detmar M, Hong Y
Blood 2010 July;116(1):140-150

---

Immunohistochemical methods for measuring tissue lymphangiogenesis.

Clasper S, Jackson DG
Methods in molecular biology (Clifton, N.J.) 2009;467:79-91

---

Endothelin-1 Stimulates Lymphatic Endothelial Cells and Lymphatic Vessels to Grow and Invade

Spinella F, Garrafa E, Di Castro V, Rosano L, Nicotra M, Caruso A, Natali P, Bagnato A
Cancer Research 2009 March;69(6):2669-2676

---

The lymphatic ring assay: a 3D-culture model of lymphangiogenesis

Françoise B, Laurence M, Sarah B, Olivier P, Jean-Michel F, Agnès N
Protocol Exchange 2008 May

---

Endosialin (Tem1) Is a Marker of Tumor-Associated Myofibroblasts and Tumor Vessel-Associated Mural Cells

Christian S, Winkler R, Helfrich I, Boos A, Besemfelder E, Schadendorf D, Augustin H
The American Journal of Pathology 2008 February;172(2):486-494

---

Altered regulation of Prox1-gene-expression in liver tumors

Dudas J, Mansuroglu T, Moriconi F, Haller F, Wilting J, Lorf T, Füzesi L, Ramadori G
BMC Cancer 2008 ;8(1):92

---

Similarities and differences of human and experimental mouse lymphangiomas

Kasten P, Schnöink G, Bergmann A, Papoutsi M, Buttler K, Rössler J, Weich H, Wilting J
Developmental Dynamics 2007 October;236(10):2952-2961

---

Elevated expression of VEGFR-3 in lymphatic endothelial cells from lymphangiomas

Norgall S, Papoutsi M, Rössler J, Schweigerer L, Wilting J, Weich H
BMC Cancer 2007 December;7(1)

---

Lymphatic reprogramming of microvascular endothelial cells by CEA-related cell adhesion molecule-1 via interaction with VEGFR-3 and Prox1.

Kilic N, Oliveira-Ferrer L, Neshat-Vahid S, Irmak S, Obst-Pernberg K, Wurmbach JH, Loges S, Kilic E, Weil J, Lauke H, Tilki D, Singer BB, Ergün S
Blood 2007 Dec 15;110(13):4223-33

---

Induction of lymphangiogenesis in and around axillary lymph node metastases of patients with breast cancer

Van den Eynden G, Van der Auwera I, Van Laere S, Huygelen V, Colpaert C, van Dam P, Dirix L, Vermeulen P, Van Marck E
British Journal of Cancer 2006 November;95(10):1362-1366

---

Differentiation of Lymphatic Endothelial Cells From Embryonic Stem Cells on OP9 Stromal Cells

Kono T
Arteriosclerosis, Thrombosis, and Vascular Biology 2006 June;26(9):2070-2076

---

Isolation and characterization of lymphatic microvascular endothelial cells from human tonsils

Garrafa E, Alessandri G, Benetti A, Turetta D, Corradi A, Cantoni A, Cervi E, Bonardelli S, Parati E, Giulini S, Ensoli B, Caruso A
Journal of Cellular Physiology 2006 April;207(1):107-113

---

Tumor Lymphangiogenesis in Inflammatory Breast Carcinoma: A Histomorphometric Study

Van der Auwera I
Clinical Cancer Research 2005 November;11(21):7637-7642

Western blot

Supportive validation

Submitted by

ReliaTech GmbH (provider)

Main image

Experimental details

Western analysis of recombinant human sLYVE-1 [Cat# S01-028] and mouse sLYVE-1 [Cat# S01-026] using an anti-human LYVE-1 polyclonal antibody [Cat# 102-PA50] directed against the extracellular domain of human LYVE-1. There is more or less no cross reactivity with mouse LYVE-1.

Sample type

Purified recombinant proteins

Immunohistochemistry

Supportive validation

Submitted by

ReliaTech GmbH (provider)

Main image

Experimental details

Immunohistochemical staining of the lymphatic vessels with anti-human LYVE-1 polyclonal antibody. (A) malignant canine mammary tumor; (B) benign canine mammary tumor; (C) normal canine mammary gland tissue. The experiment was performed by the research group of Applied Veterinary Morphology – University of Antwerp

Sample type

Malignant canine mammary tmour tissue

Supportive validation

Submitted by

ReliaTech GmbH (provider)

Main image

Experimental details

Human intestine (border area of a colon carcinoma): The experiment has been performed by Dr. Karsten Debel, DCS, Hamburg, Germany

Sample type

human intestin

Flow cytometry

Supportive validation

Submitted by

ReliaTech GmbH (provider)

Main image

Experimental details

FACS analysis with primary human dermal microvascular endothelial cells (HDMVEC).

Sample type

HDMVEC