HPA015127

antibody from Atlas Antibodies

Targeting: UGGT1 HUGT1, UGCGL1

Antibody data

Submit

Validation data

Product number: HPA015127 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA015127, RRID:AB_1858596
Product name: Anti-UGGT1
Antibody type: Polyclonal
Reactivity: Human, Mouse, Rat
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: KVKVEHVVSVLEKKYPYVEVNSILGIDSAYDRNRK EARGYYEQTGVGPLPVVLFNGMPFEREQLDPDELE TITMHKILETTTFFQRAVYLGELPHDQDVVEYIMN QPNVVPRINSRILTAERDYLDLTASNNFFVDDYA
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

UGGT1 protein structure - HPA015127 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex, liver, lymph node and testis using Anti-UGGT1 antibody HPA015127 (A) shows similar protein distribution across tissues to independent antibody HPA012761 (B).
Antibody #2 product nr: HPA012761
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human epididymis shows strong cytoplasmic positivity in glandular cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lymph node using Anti-UGGT1 antibody HPA015127.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver using Anti-UGGT1 antibody HPA015127.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis using Anti-UGGT1 antibody HPA015127.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex using Anti-UGGT1 antibody HPA015127.
Sample type: HUMAN