HPA039737

antibody from Atlas Antibodies

Targeting: SCEL FLJ21667, MGC22531

Antibody data

Submit

Validation data

Product number: HPA039737 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA039737, RRID:AB_10805485
Product name: Anti-SCEL
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: KMSPTGNEMKSTTQGTTRKQQDFHEVNKRRTFLQD NSWIKKRPEEEKDENYGRVVLNRHNSHDALDRKVN ERDVPKATISRYS
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

SCEL protein structure - HPA039737 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human esophagus and liver tissues using Anti-SCEL antibody. Corresponding SCEL RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human colon, esophagus, lymph node and testis using Anti-SCEL antibody HPA039737 (A) shows similar protein distribution across tissues to independent antibody HPA040154 (B).
Antibody #2 product nr: HPA040154
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human esophagus shows strong membranous and cytoplasmic positivity in superficial layers of squamous epithelial cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human esophagus shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lymph node using Anti-SCEL antibody HPA039737.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis using Anti-SCEL antibody HPA039737.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon using Anti-SCEL antibody HPA039737.
Sample type: HUMAN