HPA075519

antibody from Atlas Antibodies

Targeting: MAGEB2 CT3.2, DAM6, MAGE-XP-2, MGC26438

Antibody data

Submit

Validation data

Product number: HPA075519 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA075519, RRID:AB_2732294
Product name: Anti-MAGEB2
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: EGLSVVFGLELNKVNPNGHTYTFIDKVDLTDEESL LSSWDFP
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

MAGEB2 protein structure - HPA075519 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human testis and endometrium tissues using Anti-MAGEB2 antibody. Corresponding MAGEB2 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human kidney, liver, lymph node and testis using Anti-MAGEB2 antibody HPA075519 (A) shows similar protein distribution across tissues to independent antibody HPA074544 (B).
Antibody #2 product nr: HPA074544
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human endometrium shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lymph node using Anti-MAGEB2 antibody HPA075519.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney using Anti-MAGEB2 antibody HPA075519.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver using Anti-MAGEB2 antibody HPA075519.
Sample type: HUMAN