Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN182884 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Asialoglycoprotein Receptor 1 (ASGR1) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for Anti-ASGR1 antibody is: synthetic peptide directed towards the middle region of Human ASGR1
- Description
- Affinity Purified
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
RKMKSLESQLEKQQKDLSEDHSSLLLHVKQFVSDL
RSLSC QMAALQGNGS- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Synthesis and evaluation of a photoactive probe with a multivalent carbohydrate for capturing carbohydrate-lectin interactions.
Nonpalmitoylated human asialoglycoprotein receptors recycle constitutively but are defective in coated pit-mediated endocytosis, dissociation, and delivery of ligand to lysosomes.
Chang TC, Lai CH, Chien CW, Liang CF, Adak AK, Chuang YJ, Chen YJ, Lin CC
Bioconjugate chemistry 2013 Nov 20;24(11):1895-906
Bioconjugate chemistry 2013 Nov 20;24(11):1895-906
Nonpalmitoylated human asialoglycoprotein receptors recycle constitutively but are defective in coated pit-mediated endocytosis, dissociation, and delivery of ligand to lysosomes.
Yik JH, Saxena A, Weigel JA, Weigel PH
The Journal of biological chemistry 2002 Oct 25;277(43):40844-52
The Journal of biological chemistry 2002 Oct 25;277(43):40844-52
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Host: Rabbit Target Name: ASGR1 Sample Tissue: HepG2 Antibody Dilution: 1.0 μg/mL ASGR1 is supported by BioGPS gene expression data to be expressed in HepG2