Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- Immunocytochemistry [1]
- Immunoprecipitation [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00003451-D01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00003451-D01, RRID:AB_10721352
- Product name
- IFNA17 MaxPab rabbit polyclonal antibody (D01)
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against a full-length human IFNA17 protein.
- Antigen sequence
MALSFSLLMAVLVLSYKSICSLGCDLPQTHSLGNR
RALILLAQMGRISPFSCLKDRHDFGLPQEEFDGNQ
FQKTQAISVLHEMIQQTFNLFSTEDSSAAWEQSLL
EKFSTELYQQLNNLEACVIQEVGMEETPLMNEDSI
LAVRKYFQRITLYLTEKKYSPCAWEVVRAEIMRSL
SFSTNLQKILRRKD- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of IFNA17 expression in transfected 293T cell line (H00003451-T01) by IFNA17 MaxPab polyclonal antibody.Lane 1: IFNA17 transfected lysate(21.7 KDa).Lane 2: Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- IFNA17 MaxPab rabbit polyclonal antibody. Western Blot analysis of IFNA17 expression in rat brain.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of purified MaxPab antibody to IFNA17 on HeLa cell. [antibody concentration 30 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoprecipitation of IFNA17 transfected lysate using anti-IFNA17 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with IFNA17 purified MaxPab mouse polyclonal antibody (B01P) (H00003451-B01P).
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol